Lineage for d1q6ab1 (1q6a B:204-307)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018474Fold a.186: KaiA/RbsU domain [101214] (1 superfamily)
    4 helices; bundle, right-handed twist; right-handed superhelix
  4. 2018475Superfamily a.186.1: KaiA/RbsU domain [101215] (2 families) (S)
  5. 2018476Family a.186.1.1: Circadian clock protein KaiA, C-terminal domain [101216] (1 protein)
  6. 2018477Protein Circadian clock protein KaiA, C-terminal domain [101217] (3 species)
  7. 2018483Species Thermosynechococcus elongatus bp-1 [TaxId:197221] [101218] (5 PDB entries)
    Uniprot Q79V62 174-283
  8. 2018488Domain d1q6ab1: 1q6a B:204-307 [95967]
    Other proteins in same PDB: d1q6aa2, d1q6ab2

Details for d1q6ab1

PDB Entry: 1q6a (more details)

PDB Description: Solution Structure of the C-terminal Domain of Thermosynechococcus elongatus KaiA (ThKaiA180C); Averaged Minimized Structure
PDB Compounds: (B:) Circadian clock protein KaiA homolog

SCOPe Domain Sequences for d1q6ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q6ab1 a.186.1.1 (B:204-307) Circadian clock protein KaiA, C-terminal domain {Thermosynechococcus elongatus bp-1 [TaxId: 197221]}
rmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqvleihvel
mdtfskqlklegrsedilldyrltlidviahlcemyrrsiprev

SCOPe Domain Coordinates for d1q6ab1:

Click to download the PDB-style file with coordinates for d1q6ab1.
(The format of our PDB-style files is described here.)

Timeline for d1q6ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q6ab2