SCOP 1.67: Domain d1q6ab_: 1q6a B:

Lineage for d1q6ab_ (1q6a B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.186: Circadian clock protein KaiA, C-terminal domain [101214] (1 superfamily)
   4 helices; bundle, right-handed twist; right-handed superhelix

4. Superfamily a.186.1: Circadian clock protein KaiA, C-terminal domain [101215] (1 family)

5. Family a.186.1.1: Circadian clock protein KaiA, C-terminal domain [101216] (1 protein)

6. Protein Circadian clock protein KaiA, C-terminal domain [101217] (2 species)

7. Species Thermosynechococcus elongatus bp-1 [TaxId:197221] [101218] (2 PDB entries)

8. Domain d1q6ab_: 1q6a B: [95967]

Details for d1q6ab_

PDB Entry: 1q6a

PDB Description: Solution Structure of the C-terminal Domain of Thermosynechococcus elongatus KaiA (ThKaiA180C); Averaged Minimized Structure

SCOP Domain Sequences for d1q6ab_:

Sequence; same for both SEQRES and ATOM records:

>d1q6ab_ a.186.1.1 (B:) Circadian clock protein KaiA, C-terminal domain {Thermosynechococcus elongatus bp-1}
amarmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqvleih
velmdtfskqlklegrsedilldyrltlidviahlcemyrrsiprev

Timeline for d1q6ab_:

• d1q6ab_ is new in SCOP 1.67
  
• d1q6ab_ appears in SCOP 1.69
  
• d1q6ab_ appears in the current release, SCOPe 2.08, called d1q6ab1