Lineage for d1q67b_ (1q67 B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 673403Family b.55.1.7: Dcp1 [101836] (1 protein)
    close structural similarity to EVH1 domain
  6. 673404Protein Dcp1 [101837] (1 species)
    decapping protein involved in mRNA degradation
  7. 673405Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101838] (1 PDB entry)
  8. 673407Domain d1q67b_: 1q67 B: [95961]

Details for d1q67b_

PDB Entry: 1q67 (more details), 2.3 Å

PDB Description: Crystal structure of Dcp1p
PDB Compounds: (B:) Decapping protein involved in mRNA degradation-Dcp1p

SCOP Domain Sequences for d1q67b_:

Sequence, based on SEQRES records: (download)

>d1q67b_ b.55.1.7 (B:) Dcp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fyrkalnfnvigrydpkikqllfhtphaslykwdfkkdewnkleyqgvlaiylrdvsqnt
nllpvspqevdifdsqngsnniqvnngsdnsnrnssgngnsyksndsltyncgktlsgkd
iynygliilnrinpdnfsmgivpnsvvnkrkvfnaeedtlnplecmgvevkdelviiknl
khevygiwihtvsdrqniyelikyllenepkdsfa

Sequence, based on observed residues (ATOM records): (download)

>d1q67b_ b.55.1.7 (B:) Dcp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fyrkalnfnvigrydpkikqllfhtphaslykwdfkkdewnkleyqgvlaiylrdvsqnt
nllpkdiynygliilnrinpdnfsmgivpnsvvnkrkvfnaeedtlnplecmgvevkdel
viiknlkhevygiwihtvsdrqniyelikyllenepkdsfa

SCOP Domain Coordinates for d1q67b_:

Click to download the PDB-style file with coordinates for d1q67b_.
(The format of our PDB-style files is described here.)

Timeline for d1q67b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1q67a_