Lineage for d1q5xc_ (1q5x C:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 389637Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 389926Superfamily c.8.7: RraA-like [89562] (1 family) (S)
    structural similarity and possible distant homology to the phosphohistidine domain of pyruvate phosphate dikinase
  5. 389927Family c.8.7.1: RraA-like [89563] (4 proteins)
    aka MenG-like; characterized as regulator of RNase E activity A (RraA) that globally modulates RNA abundance in E. coli
  6. 389944Protein Regulator of RNase E activity RraA (MenG) [102192] (1 species)
  7. 389945Species Escherichia coli [TaxId:562] [102193] (1 PDB entry)
  8. 389948Domain d1q5xc_: 1q5x C: [95949]

Details for d1q5xc_

PDB Entry: 1q5x (more details), 2 Å

PDB Description: structure of of rraa (meng), a protein inhibitor of rna processing

SCOP Domain Sequences for d1q5xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q5xc_ c.8.7.1 (C:) Regulator of RNase E activity RraA (MenG) {Escherichia coli}
kydtselcdiyqedvnvveplfsnfggrasfggqiitvkcfedngllydlleqngrgrvl
vvdgggsvrralvdaelarlavqneweglviygavrqvddleeldigiqamaaipvgaag
egigesdvrvnfggvtffsgdhlyadntgiilsed

SCOP Domain Coordinates for d1q5xc_:

Click to download the PDB-style file with coordinates for d1q5xc_.
(The format of our PDB-style files is described here.)

Timeline for d1q5xc_: