| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.7: RraA-like [89562] (2 families) ![]() structural similarity and possible distant homology to the phosphohistidine domain of pyruvate phosphate dikinase |
| Family c.8.7.1: RraA-like [89563] (5 proteins) aka MenG-like; characterized as regulator of RNase E activity A (RraA) that globally modulates RNA abundance in E. coli automatically mapped to Pfam PF03737 |
| Protein Regulator of RNase E activity RraA (MenG) [102192] (1 species) |
| Species Escherichia coli [TaxId:562] [102193] (1 PDB entry) |
| Domain d1q5xc_: 1q5x C: [95949] |
PDB Entry: 1q5x (more details), 2 Å
SCOPe Domain Sequences for d1q5xc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q5xc_ c.8.7.1 (C:) Regulator of RNase E activity RraA (MenG) {Escherichia coli [TaxId: 562]}
kydtselcdiyqedvnvveplfsnfggrasfggqiitvkcfedngllydlleqngrgrvl
vvdgggsvrralvdaelarlavqneweglviygavrqvddleeldigiqamaaipvgaag
egigesdvrvnfggvtffsgdhlyadntgiilsed
Timeline for d1q5xc_: