SCOPe 2.06: Domain d1q5xb_: 1q5x B:

Lineage for d1q5xb_ (1q5x B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.7: RraA-like [89562] (2 families)
   structural similarity and possible distant homology to the phosphohistidine domain of pyruvate phosphate dikinase

5. Family c.8.7.1: RraA-like [89563] (5 proteins)
   aka MenG-like; characterized as regulator of RNase E activity A (RraA) that globally modulates RNA abundance in E. coli
   automatically mapped to Pfam PF03737

6. Protein Regulator of RNase E activity RraA (MenG) [102192] (1 species)

7. Species Escherichia coli [TaxId:562] [102193] (1 PDB entry)

8. Domain d1q5xb_: 1q5x B: [95948]

Details for d1q5xb_

PDB Entry: 1q5x, 2 Å

PDB Description: structure of of rraa (meng), a protein inhibitor of rna processing

PDB Compounds: (B:) regulator of RNAse e activity a

SCOPe Domain Sequences for d1q5xb_:

Sequence; same for both SEQRES and ATOM records:

>d1q5xb_ c.8.7.1 (B:) Regulator of RNase E activity RraA (MenG) {Escherichia coli [TaxId: 562]}
kydtselcdiyqedvnvveplfsnfggrasfggqiitvkcfedngllydlleqngrgrvl
vvdgggsvrralvdaelarlavqneweglviygavrqvddleeldigiqamaaipvgaag
egigesdvrvnfggvtffsgdhlyadntgiilsedpld

Timeline for d1q5xb_:

• d1q5xb_ first appeared in SCOP 1.67
  
• d1q5xb_ appears in SCOPe 2.05
  
• d1q5xb_ appears in SCOPe 2.07
  
• d1q5xb_ appears in the current release, SCOPe 2.08