Lineage for d1q5xb_ (1q5x B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1834037Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 1834483Superfamily c.8.7: RraA-like [89562] (2 families) (S)
    structural similarity and possible distant homology to the phosphohistidine domain of pyruvate phosphate dikinase
  5. 1834484Family c.8.7.1: RraA-like [89563] (5 proteins)
    aka MenG-like; characterized as regulator of RNase E activity A (RraA) that globally modulates RNA abundance in E. coli
    automatically mapped to Pfam PF03737
  6. 1834501Protein Regulator of RNase E activity RraA (MenG) [102192] (1 species)
  7. 1834502Species Escherichia coli [TaxId:562] [102193] (1 PDB entry)
  8. 1834504Domain d1q5xb_: 1q5x B: [95948]

Details for d1q5xb_

PDB Entry: 1q5x (more details), 2 Å

PDB Description: structure of of rraa (meng), a protein inhibitor of rna processing
PDB Compounds: (B:) regulator of RNAse e activity a

SCOPe Domain Sequences for d1q5xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q5xb_ c.8.7.1 (B:) Regulator of RNase E activity RraA (MenG) {Escherichia coli [TaxId: 562]}
kydtselcdiyqedvnvveplfsnfggrasfggqiitvkcfedngllydlleqngrgrvl
vvdgggsvrralvdaelarlavqneweglviygavrqvddleeldigiqamaaipvgaag
egigesdvrvnfggvtffsgdhlyadntgiilsedpld

SCOPe Domain Coordinates for d1q5xb_:

Click to download the PDB-style file with coordinates for d1q5xb_.
(The format of our PDB-style files is described here.)

Timeline for d1q5xb_: