Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (12 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (1 protein) |
Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species) |
Species Escherichia coli [TaxId:562] [103001] (4 PDB entries) |
Domain d1q5vc2: 1q5v C:49-132 [95942] Other proteins in same PDB: d1q5va1, d1q5vb1, d1q5vc1, d1q5vd1 |
PDB Entry: 1q5v (more details), 2.3 Å
SCOP Domain Sequences for d1q5vc2:
Sequence, based on SEQRES records: (download)
>d1q5vc2 d.58.18.4 (C:49-132) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]} gtqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdv qhfaddviaqrgvrhghlqclpke
>d1q5vc2 d.58.18.4 (C:49-132) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]} gtqgfavlsyvyehdlsvatlhvhinhddcleiavlkgdmgdvqhfaddviaqrgvrhgh lqclpke
Timeline for d1q5vc2: