![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.18: ACT-like [55021] (5 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
![]() | Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (1 protein) |
![]() | Protein Nickel responsive regulator NikR, C-terminal domain [103000] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [103001] (2 PDB entries) |
![]() | Domain d1q5vc2: 1q5v C:49-132 [95942] Other proteins in same PDB: d1q5va1, d1q5vb1, d1q5vc1, d1q5vd1 |
PDB Entry: 1q5v (more details), 2.3 Å
SCOP Domain Sequences for d1q5vc2:
Sequence, based on SEQRES records: (download)
>d1q5vc2 d.58.18.4 (C:49-132) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli} gtqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdv qhfaddviaqrgvrhghlqclpke
>d1q5vc2 d.58.18.4 (C:49-132) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli} gtqgfavlsyvyehdlsvatlhvhinhddcleiavlkgdmgdvqhfaddviaqrgvrhgh lqclpke
Timeline for d1q5vc2: