Lineage for d1q5va2 (1q5v A:49-132)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560919Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2560963Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 proteins)
    automatically mapped to Pfam PF08753
  6. 2560964Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species)
  7. 2560965Species Escherichia coli [TaxId:562] [103001] (8 PDB entries)
  8. 2560977Domain d1q5va2: 1q5v A:49-132 [95938]
    Other proteins in same PDB: d1q5va1, d1q5vb1, d1q5vc1, d1q5vd1
    apo form

Details for d1q5va2

PDB Entry: 1q5v (more details), 2.3 Å

PDB Description: Apo-NikR
PDB Compounds: (A:) nickel responsive regulator

SCOPe Domain Sequences for d1q5va2:

Sequence, based on SEQRES records: (download)

>d1q5va2 d.58.18.4 (A:49-132) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]}
gtqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdv
qhfaddviaqrgvrhghlqclpke

Sequence, based on observed residues (ATOM records): (download)

>d1q5va2 d.58.18.4 (A:49-132) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]}
gtqgfavlsyvyehhdlsvatlhvhinhddcleiavlkgdmgdvqhfaddviaqrgvrhg
hlqclpke

SCOPe Domain Coordinates for d1q5va2:

Click to download the PDB-style file with coordinates for d1q5va2.
(The format of our PDB-style files is described here.)

Timeline for d1q5va2: