SCOPe 2.07: Domain d1q5uz1: 1q5u Z:1-126

Lineage for d1q5uz1 (1q5u Z:1-126)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102010] (2 PDB entries)

8. Domain d1q5uz1: 1q5u Z:1-126 [95936]
   Other proteins in same PDB: d1q5ux2, d1q5uy2, d1q5uz2

Details for d1q5uz1

PDB Entry: 1q5u, 2 Å

PDB Description: human dutp pyrophosphatase

PDB Compounds: (Z:) dUTP pyrophosphatase

SCOPe Domain Sequences for d1q5uz1:

Sequence; same for both SEQRES and ATOM records:

>d1q5uz1 b.85.4.1 (Z:1-126) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]}
mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
evqald

Timeline for d1q5uz1:

• d1q5uz1 first appeared in SCOP 1.67, called d1q5uz_
  
• d1q5uz1 appears in SCOPe 2.06
  
• d1q5uz1 appears in the current release, SCOPe 2.08