Lineage for d1q5uy_ (1q5u Y:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678386Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 678502Superfamily b.85.4: dUTPase-like [51283] (1 family) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 678503Family b.85.4.1: dUTPase-like [51284] (4 proteins)
  6. 678534Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (6 species)
  7. 678566Species Human (Homo sapiens) [TaxId:9606] [102010] (2 PDB entries)
  8. 678571Domain d1q5uy_: 1q5u Y: [95935]

Details for d1q5uy_

PDB Entry: 1q5u (more details), 2 Å

PDB Description: human dutp pyrophosphatase
PDB Compounds: (Y:) dUTP pyrophosphatase

SCOP Domain Sequences for d1q5uy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q5uy_ b.85.4.1 (Y:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]}
hmqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrv
aprsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypei
eevqald

SCOP Domain Coordinates for d1q5uy_:

Click to download the PDB-style file with coordinates for d1q5uy_.
(The format of our PDB-style files is described here.)

Timeline for d1q5uy_: