Lineage for d1q5ux1 (1q5u X:1-128)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427417Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2427418Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2427488Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 2427522Species Human (Homo sapiens) [TaxId:9606] [102010] (2 PDB entries)
  8. 2427526Domain d1q5ux1: 1q5u X:1-128 [95934]
    Other proteins in same PDB: d1q5ux2, d1q5uy2, d1q5uz2

Details for d1q5ux1

PDB Entry: 1q5u (more details), 2 Å

PDB Description: human dutp pyrophosphatase
PDB Compounds: (X:) dUTP pyrophosphatase

SCOPe Domain Sequences for d1q5ux1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q5ux1 b.85.4.1 (X:1-128) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]}
mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
evqalddt

SCOPe Domain Coordinates for d1q5ux1:

Click to download the PDB-style file with coordinates for d1q5ux1.
(The format of our PDB-style files is described here.)

Timeline for d1q5ux1: