SCOPe 2.05: Domain d1q5ux_: 1q5u X:

Lineage for d1q5ux_ (1q5u X:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102010] (2 PDB entries)

8. Domain d1q5ux_: 1q5u X: [95934]

Details for d1q5ux_

PDB Entry: 1q5u, 2 Å

PDB Description: human dutp pyrophosphatase

PDB Compounds: (X:) dUTP pyrophosphatase

SCOPe Domain Sequences for d1q5ux_:

Sequence; same for both SEQRES and ATOM records:

>d1q5ux_ b.85.4.1 (X:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]}
hhhmqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcyg
rvaprsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifyp
eieevqalddt

Timeline for d1q5ux_:

• d1q5ux_ first appeared in SCOP 1.67
  
• d1q5ux_ appears in SCOPe 2.04
  
• d1q5ux_ is called d1q5ux1 in SCOPe 2.06
  
• d1q5ux_ appears in the current release, SCOPe 2.08, called d1q5ux1