Lineage for d1q5tb_ (1q5t B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449032Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 449033Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 449038Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 449118Protein Snake phospholipase A2 [48624] (35 species)
  7. 449235Species Sand viper (Vipera ammodytes meridionalis), vipoxin inhibitor [TaxId:8704] [88517] (4 PDB entries)
  8. 449240Domain d1q5tb_: 1q5t B: [95933]

Details for d1q5tb_

PDB Entry: 1q5t (more details), 1.9 Å

PDB Description: Gln48 PLA2 separated from Vipoxin from the venom of Vipera ammodytes meridionalis.

SCOP Domain Sequences for d1q5tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q5tb_ a.133.1.2 (B:) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin inhibitor}
nlfqfgdmilqktgkeavhsyaiygcycgwggqgraqdatdrccfaqdccygrnlvcnpk
tatytysfengdivcgdndlclravcecdraaaiclgenvntydknyeyysishcteese
qc

SCOP Domain Coordinates for d1q5tb_:

Click to download the PDB-style file with coordinates for d1q5tb_.
(The format of our PDB-style files is described here.)

Timeline for d1q5tb_: