Lineage for d1q5ql_ (1q5q L:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2990986Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2993205Species Rhodococcus erythropolis [TaxId:1833] [103313] (3 PDB entries)
  8. 2993210Domain d1q5ql_: 1q5q L: [95915]
    Other proteins in same PDB: d1q5qa_, d1q5qb_, d1q5qc_, d1q5qd_, d1q5qe_, d1q5qf_, d1q5qg_

Details for d1q5ql_

PDB Entry: 1q5q (more details), 2.6 Å

PDB Description: The Rhodococcus 20S proteasome
PDB Compounds: (L:) proteasome beta-type subunit 1

SCOPe Domain Sequences for d1q5ql_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q5ql_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]}
ttivaltykggvllagdrratqgnliasrdvekvyvtdeysaagiagtagiaielvrlfa
velehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddesragri
vsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaadddsa
tggpdltrgiyptavtitqagavhvseettselarrivaerteq

SCOPe Domain Coordinates for d1q5ql_:

Click to download the PDB-style file with coordinates for d1q5ql_.
(The format of our PDB-style files is described here.)

Timeline for d1q5ql_: