![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein Proteasome beta subunit (catalytic) [56252] (7 species) |
![]() | Species Rhodococcus erythropolis [TaxId:1833] [103313] (3 PDB entries) |
![]() | Domain d1q5ql_: 1q5q L: [95915] Other proteins in same PDB: d1q5qa_, d1q5qb_, d1q5qc_, d1q5qd_, d1q5qe_, d1q5qf_, d1q5qg_ |
PDB Entry: 1q5q (more details), 2.6 Å
SCOPe Domain Sequences for d1q5ql_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q5ql_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} ttivaltykggvllagdrratqgnliasrdvekvyvtdeysaagiagtagiaielvrlfa velehyekiegvpltfdgkanrlasmvrgnlgaamqglavvpllvgydldaddesragri vsydvvggryeeragyhavgsgslfaksalkkiyspdsdeetalraaieslydaadddsa tggpdltrgiyptavtitqagavhvseettselarrivaerteq
Timeline for d1q5ql_: