SCOPe 2.05: Domain d1q5oa_: 1q5o A:

Lineage for d1q5oa_ (1q5o A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein HCN pacemaker channel [101993] (1 species)
   potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel

7. Species Mouse (Mus musculus) [TaxId:10090] [101994] (5 PDB entries)

8. Domain d1q5oa_: 1q5o A: [95902]
   complexed with cmp

Details for d1q5oa_

PDB Entry: 1q5o, 2.3 Å

PDB Description: HCN2J 443-645 in the presence of cAMP, selenomethionine derivative

PDB Compounds: (A:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2

SCOPe Domain Sequences for d1q5oa_:

Sequence; same for both SEQRES and ATOM records:

>d1q5oa_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetvaidrldrigkknsil

Timeline for d1q5oa_:

• d1q5oa_ first appeared in SCOP 1.67
  
• d1q5oa_ appears in SCOPe 2.04
  
• d1q5oa_ appears in SCOPe 2.06
  
• d1q5oa_ appears in the current release, SCOPe 2.08