Lineage for d1q5na_ (1q5n A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010258Protein 3-carboxy-cis,cis-muconate cycloisomerase (CMLE) [101444] (2 species)
  7. 2010259Species Acinetobacter calcoaceticus [TaxId:471] [101445] (1 PDB entry)
  8. 2010260Domain d1q5na_: 1q5n A: [95901]

Details for d1q5na_

PDB Entry: 1q5n (more details), 2.3 Å

PDB Description: crystal structure of beta-carboxy-cis,cis-muconate cycloisomerase (cmle) from acinetobacter calcoaceticus sp. adp1
PDB Compounds: (A:) 3-carboxy-cis,cis-muconate cycloisomerase

SCOPe Domain Sequences for d1q5na_:

Sequence, based on SEQRES records: (download)

>d1q5na_ a.127.1.1 (A:) 3-carboxy-cis,cis-muconate cycloisomerase (CMLE) {Acinetobacter calcoaceticus [TaxId: 471]}
qlyaslfyqrdvteifsdralvsymveaevalaqaqaqvgvipqsaatviqraaktaidk
idfdalatatglagniaipfvkqltaivkdadedaaryvhwgatsqdildtacilqcrda
laivqnqvqqcyetalsqaqtyrhqvmmgrtwlqqalpitlghklarwasafkrdldrin
aikarvlvaqlggavgslaslqdqgsivveayakqlklgqtactwhgerdriveiasvlg
iitgnvgkmardwslmmqteiaevfeptakgrggsstmphkrnpvaaasvlaaanrvpal
mssiyqsmvqeherslgawhaewlslpeifqltagalertldvlkgmevnaenmhqniec
thglimaeavmmalaphmgrlnahhvveaacktavaeqkhlkdiisqvdevkqyfnpsql
deifkpesylgniqdqidavlqea

Sequence, based on observed residues (ATOM records): (download)

>d1q5na_ a.127.1.1 (A:) 3-carboxy-cis,cis-muconate cycloisomerase (CMLE) {Acinetobacter calcoaceticus [TaxId: 471]}
qlyaslfyqrdvteifsdralvsymveaevalaqaqaqvgvipqsaatviqraaktaidk
idfdalatatglagniaipfvkqltaivkdadedaaryvhwgatsqdildtacilqcrda
laivqnqvqqcyetalsqaqtyrhqvmmgrtwlqqalpitlghklarwasafkrdldrin
aikarvlvaqlggavgslaslqdqgsivveayakqlklgqtactwhgerdriveiasvlg
iitgnvgkmardwslmmqteiaevfeptrnpvaaasvlaaanrvpalmssiyqsmvqehe
rslgawhaewlslpeifqltagalertldvlkgmevnaenmhqniecthglimaeavmma
laphmgrlnahhvveaacktavaeqkhlkdiisqvdevkqyfnpsqldeifkpesylgni
qdqidavlqea

SCOPe Domain Coordinates for d1q5na_:

Click to download the PDB-style file with coordinates for d1q5na_.
(The format of our PDB-style files is described here.)

Timeline for d1q5na_: