![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily) beta-sandwich: 8 strands in 2 sheets |
![]() | Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) ![]() |
![]() | Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (1 protein) |
![]() | Protein DnaK [100922] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [100923] (7 PDB entries) |
![]() | Domain d1q5la_: 1q5l A: [95900] complexed with peptide nrllltg, chain B |
PDB Entry: 1q5l (more details)
SCOP Domain Sequences for d1q5la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q5la_ b.130.1.1 (A:) DnaK {Escherichia coli} dvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihvlqgerkraadnk slgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassgl
Timeline for d1q5la_: