Lineage for d1q5la_ (1q5l A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2077465Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
    beta-sandwich: 8 strands in 2 sheets
  4. 2077466Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) (S)
  5. 2077467Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 protein domains)
  6. 2077471Protein DnaK [100922] (3 species)
  7. 2077475Species Escherichia coli [TaxId:562] [100923] (7 PDB entries)
  8. 2077483Domain d1q5la_: 1q5l A: [95900]
    complexed with peptide nrllltg, chain B

Details for d1q5la_

PDB Entry: 1q5l (more details)

PDB Description: NMR structure of the substrate binding domain of DnaK bound to the peptide NRLLLTG
PDB Compounds: (A:) Chaperone protein dnaK

SCOPe Domain Sequences for d1q5la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q5la_ b.130.1.1 (A:) DnaK {Escherichia coli [TaxId: 562]}
dvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihvlqgerkraadnk
slgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassgl

SCOPe Domain Coordinates for d1q5la_:

Click to download the PDB-style file with coordinates for d1q5la_.
(The format of our PDB-style files is described here.)

Timeline for d1q5la_: