Class b: All beta proteins [48724] (176 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species) |
Domain d1q5hb_: 1q5h B: [95894] protein/DNA complex; complexed with dud, mg |
PDB Entry: 1q5h (more details), 2 Å
SCOPe Domain Sequences for d1q5hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q5hb_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]} mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie evqalddtergsggfg
Timeline for d1q5hb_: