Lineage for d1q5ea_ (1q5e A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2331449Protein Cytochrome P450epok [101369] (1 species)
  7. 2331450Species Sorangium cellulosum [TaxId:56] [101370] (3 PDB entries)
  8. 2331453Domain d1q5ea_: 1q5e A: [95892]
    complexed with hem

Details for d1q5ea_

PDB Entry: 1q5e (more details), 2.65 Å

PDB Description: substrate-free cytochrome p450epok
PDB Compounds: (A:) P450 epoxidase

SCOPe Domain Sequences for d1q5ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q5ea_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]}
pafdfkpfapgyaedpfpaierlreatpifywdegrswvltryhdvsavfrderfavsre
ewessaeyssaipelsdmkkyglfglppedharvrklvnpsftsraidllraeiqrtvdq
lldarsgqeefdvvrdyaegipmraisallkvpaecdekfrrfgsataralgvglvprvd
eetktlvasvteglallhgvlderrrnplendvltmllqaeadgsrlstkelvalvgaii
aagtdttiyliafavlnllrspealelvkaepglmrnaldevlrfdnilrigtvrfarqd
leycgasikkgemvfllipsalrdgtvfsrpdvfdvrrdtsaslaygrgphvcpgvslar
leaeiavgtifrrfpemklketpvfgyhpafrnieslnvilkps

SCOPe Domain Coordinates for d1q5ea_:

Click to download the PDB-style file with coordinates for d1q5ea_.
(The format of our PDB-style files is described here.)

Timeline for d1q5ea_: