Lineage for d1q5da_ (1q5d A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005347Protein Cytochrome P450epok [101369] (1 species)
  7. 2005348Species Sorangium cellulosum [TaxId:56] [101370] (3 PDB entries)
  8. 2005349Domain d1q5da_: 1q5d A: [95891]
    complexed with epb, hem

Details for d1q5da_

PDB Entry: 1q5d (more details), 1.93 Å

PDB Description: Epothilone B-bound Cytochrome P450epoK
PDB Compounds: (A:) P450 epoxidase

SCOPe Domain Sequences for d1q5da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]}
dfkpfapgyaedpfpaierlreatpifywdegrswvltryhdvsavfrderfavsreewe
ssaeyssaipelsdmkkyglfglppedharvrklvnpsftsraidllraeiqrtvdqlld
arsgqeefdvvrdyaegipmraisallkvpaecdekfrrfgsataralgvglvprvdeet
ktlvasvteglallhgvlderrrnplendvltmllqaeadgsrlstkelvalvgaiiaag
tdttiyliafavlnllrspealelvkaepglmrnaldevlrfdnilrigtvrfarqdley
cgasikkgemvfllipsalrdgtvfsrpdvfdvrrdtsaslaygrgphvcpgvslarlea
eiavgtifrrfpemklketpvfgyhpafrnieslnvilkps

SCOPe Domain Coordinates for d1q5da_:

Click to download the PDB-style file with coordinates for d1q5da_.
(The format of our PDB-style files is described here.)

Timeline for d1q5da_: