SCOPe 2.02: Domain d1q59a_: 1q59 A:

Lineage for d1q59a_ (1q59 A:)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Early antigen protein R [103426] (1 species)

7. Species Epstein-Barr virus [TaxId:10376] [103427] (1 PDB entry)

8. Domain d1q59a_: 1q59 A: [95881]

Details for d1q59a_

PDB Entry: 1q59

PDB Description: solution structure of the bhrf1 protein from epstein-barr virus, a homolog of human bcl-2

PDB Compounds: (A:) Early antigen protein R

SCOPe Domain Sequences for d1q59a_:

Sequence; same for both SEQRES and ATOM records:

>d1q59a_ f.1.4.1 (A:) Early antigen protein R {Epstein-Barr virus [TaxId: 10376]}
maystreillalcirdsrvhgngtlhpvlelaaretplrlspedtvvlryhvlleeiier
nsetftetwnrfithtehvdldfnsvfleifhrgdpslgralawmawcmhacrtlccnqs
tpyyvvdlsvrgmleasegldgwihqqggwstliednipgddddlehhhhhh

Timeline for d1q59a_:

• d1q59a_ first appeared in SCOP 1.67
  
• d1q59a_ appears in SCOPe 2.01
  
• d1q59a_ appears in SCOPe 2.03
  
• d1q59a_ appears in the current release, SCOPe 2.08, called d1q59a1