Class f: Membrane and cell surface proteins and peptides [56835] (42 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (8 proteins) |
Protein Early antigen protein R [103426] (1 species) |
Species Epstein-Barr virus [TaxId:10376] [103427] (1 PDB entry) |
Domain d1q59a_: 1q59 A: [95881] |
PDB Entry: 1q59 (more details)
SCOP Domain Sequences for d1q59a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q59a_ f.1.4.1 (A:) Early antigen protein R {Epstein-Barr virus} maystreillalcirdsrvhgngtlhpvlelaaretplrlspedtvvlryhvlleeiier nsetftetwnrfithtehvdldfnsvfleifhrgdpslgralawmawcmhacrtlccnqs tpyyvvdlsvrgmleasegldgwihqqggwstliednipgddddlehhhhhh
Timeline for d1q59a_: