Lineage for d1q59a1 (1q59 A:1-160)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021130Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 3021300Protein Early antigen protein R [103426] (1 species)
  7. 3021301Species Epstein-Barr virus [TaxId:10376] [103427] (1 PDB entry)
  8. 3021302Domain d1q59a1: 1q59 A:1-160 [95881]
    Other proteins in same PDB: d1q59a2

Details for d1q59a1

PDB Entry: 1q59 (more details)

PDB Description: solution structure of the bhrf1 protein from epstein-barr virus, a homolog of human bcl-2
PDB Compounds: (A:) Early antigen protein R

SCOPe Domain Sequences for d1q59a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q59a1 f.1.4.1 (A:1-160) Early antigen protein R {Epstein-Barr virus [TaxId: 10376]}
maystreillalcirdsrvhgngtlhpvlelaaretplrlspedtvvlryhvlleeiier
nsetftetwnrfithtehvdldfnsvfleifhrgdpslgralawmawcmhacrtlccnqs
tpyyvvdlsvrgmleasegldgwihqqggwstliednipg

SCOPe Domain Coordinates for d1q59a1:

Click to download the PDB-style file with coordinates for d1q59a1.
(The format of our PDB-style files is described here.)

Timeline for d1q59a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q59a2