![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
![]() | Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) ![]() PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
![]() | Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
![]() | Protein Early antigen protein R [103426] (1 species) |
![]() | Species Epstein-Barr virus [TaxId:10376] [103427] (1 PDB entry) |
![]() | Domain d1q59a1: 1q59 A:1-160 [95881] Other proteins in same PDB: d1q59a2 |
PDB Entry: 1q59 (more details)
SCOPe Domain Sequences for d1q59a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q59a1 f.1.4.1 (A:1-160) Early antigen protein R {Epstein-Barr virus [TaxId: 10376]} maystreillalcirdsrvhgngtlhpvlelaaretplrlspedtvvlryhvlleeiier nsetftetwnrfithtehvdldfnsvfleifhrgdpslgralawmawcmhacrtlccnqs tpyyvvdlsvrgmleasegldgwihqqggwstliednipg
Timeline for d1q59a1: