SCOPe 2.07: Domain d1q57f2: 1q57 F:64-263

Lineage for d1q57f2 (1q57 F:64-263)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.13: DNA primase core [56730] (1 superfamily)
   2 domains: (1) alpha+beta; (2) toprim alpha/beta

4. Superfamily e.13.1: DNA primase core [56731] (3 families)

5. Family e.13.1.2: Primase fragment of primase-helicase protein [90090] (1 protein)

6. Protein Primase fragment of primase-helicase protein [90091] (1 species)

7. Species Bacteriophage T7 [TaxId:10760] [90092] (2 PDB entries)

8. Domain d1q57f2: 1q57 F:64-263 [95878]
   Other proteins in same PDB: d1q57a1, d1q57b1, d1q57c1, d1q57d1, d1q57e1, d1q57f1, d1q57g1

Details for d1q57f2

PDB Entry: 1q57, 3.45 Å

PDB Description: the crystal structure of the bifunctional primase-helicase of bacteriophage t7

PDB Compounds: (F:) DNA primase/helicase

SCOPe Domain Sequences for d1q57f2:

Sequence; same for both SEQRES and ATOM records:

>d1q57f2 e.13.1.2 (F:64-263) Primase fragment of primase-helicase protein {Bacteriophage T7 [TaxId: 10760]}
mtynvwnfgesngrysaltargisketcqkagywiakvdgvmyqvadyrdqngnivsqkv
rdkdknfkttgshksdalfgkhlwnggkkivvtegeidmltvmelqdckypvvslghgas
aakktcaanyeyfdqfeqiilmfdmdeagrkaveeaaqvlpagkvrvavlpckdanechl
nghdreimeqvwnagpwipd

Timeline for d1q57f2:

• d1q57f2 first appeared in SCOP 1.67
  
• d1q57f2 appears in SCOPe 2.06
  
• d1q57f2 appears in the current release, SCOPe 2.08