Lineage for d1q57a1 (1q57 A:264-549)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112477Protein Gene 4 protein (g4p, DNA primase), helicase domain [52674] (1 species)
  7. 2112478Species Bacteriophage T7 [TaxId:10760] [52675] (7 PDB entries)
  8. 2112495Domain d1q57a1: 1q57 A:264-549 [95867]
    Other proteins in same PDB: d1q57a2, d1q57b2, d1q57c2, d1q57d2, d1q57e2, d1q57f2, d1q57g2

Details for d1q57a1

PDB Entry: 1q57 (more details), 3.45 Å

PDB Description: The Crystal Structure of the Bifunctional Primase-Helicase of Bacteriophage T7
PDB Compounds: (A:) DNA primase/helicase

SCOPe Domain Sequences for d1q57a1:

Sequence, based on SEQRES records: (download)

>d1q57a1 c.37.1.11 (A:264-549) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}
gvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmvmstfvr
qqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqwfd
elfgndtfhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkmid
nlmtklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiiale
rnqqgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg

Sequence, based on observed residues (ATOM records): (download)

>d1q57a1 c.37.1.11 (A:264-549) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}
gvvsalslrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmvmstfvr
qqalqwgtamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqwfd
elfgndtfhlydsfetdrllaklaymrsglgcdviildhisivvsasgesderkmidnlm
tklkgfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiialernq
qgdmpnlvlvrilkcrftgdtgiagymeynketgwlepssysg

SCOPe Domain Coordinates for d1q57a1:

Click to download the PDB-style file with coordinates for d1q57a1.
(The format of our PDB-style files is described here.)

Timeline for d1q57a1: