Lineage for d1q56a_ (1q56 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1780927Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 1780928Protein Agrin [101641] (1 species)
    alternative splicing
  7. 1780929Species Chicken (Gallus gallus) [TaxId:9031] [101642] (4 PDB entries)
  8. 1780938Domain d1q56a_: 1q56 A: [95866]

Details for d1q56a_

PDB Entry: 1q56 (more details)

PDB Description: NMR structure of the B0 isoform of the agrin G3 domain in its Ca2+ bound state
PDB Compounds: (A:) Agrin

SCOPe Domain Sequences for d1q56a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q56a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]}
gsekviiekaagdaeaiafdgrtymeyhnavtksekalqsnhfelsikteatqglilwsg
kglersdyialaivdgfvqmmydlgskpvvlrstvpintnhwthikayrvqregslqvgn
eapitgssplgatqldtdgalwlggmerlsvahklpkaystgfigcirdvivdrqelhlv
edalnnptilhcsak

SCOPe Domain Coordinates for d1q56a_:

Click to download the PDB-style file with coordinates for d1q56a_.
(The format of our PDB-style files is described here.)

Timeline for d1q56a_: