Lineage for d1q56a1 (1q56 A:3-195)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779532Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 2779533Protein Agrin [101641] (1 species)
    alternative splicing
  7. 2779534Species Chicken (Gallus gallus) [TaxId:9031] [101642] (4 PDB entries)
  8. 2779543Domain d1q56a1: 1q56 A:3-195 [95866]
    Other proteins in same PDB: d1q56a2

Details for d1q56a1

PDB Entry: 1q56 (more details)

PDB Description: nmr structure of the b0 isoform of the agrin g3 domain in its ca2+ bound state
PDB Compounds: (A:) Agrin

SCOPe Domain Sequences for d1q56a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q56a1 b.29.1.4 (A:3-195) Agrin {Chicken (Gallus gallus) [TaxId: 9031]}
ekviiekaagdaeaiafdgrtymeyhnavtksekalqsnhfelsikteatqglilwsgkg
lersdyialaivdgfvqmmydlgskpvvlrstvpintnhwthikayrvqregslqvgnea
pitgssplgatqldtdgalwlggmerlsvahklpkaystgfigcirdvivdrqelhlved
alnnptilhcsak

SCOPe Domain Coordinates for d1q56a1:

Click to download the PDB-style file with coordinates for d1q56a1.
(The format of our PDB-style files is described here.)

Timeline for d1q56a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q56a2