SCOPe 2.08: Domain d1q56a1: 1q56 A:3-195

Lineage for d1q56a1 (1q56 A:3-195)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.4: Laminin G-like module [49944] (7 proteins)

6. Protein Agrin [101641] (1 species)
   alternative splicing

7. Species Chicken (Gallus gallus) [TaxId:9031] [101642] (4 PDB entries)

8. Domain d1q56a1: 1q56 A:3-195 [95866]
   Other proteins in same PDB: d1q56a2

Details for d1q56a1

PDB Entry: 1q56

PDB Description: nmr structure of the b0 isoform of the agrin g3 domain in its ca2+ bound state

PDB Compounds: (A:) Agrin

SCOPe Domain Sequences for d1q56a1:

Sequence; same for both SEQRES and ATOM records:

>d1q56a1 b.29.1.4 (A:3-195) Agrin {Chicken (Gallus gallus) [TaxId: 9031]}
ekviiekaagdaeaiafdgrtymeyhnavtksekalqsnhfelsikteatqglilwsgkg
lersdyialaivdgfvqmmydlgskpvvlrstvpintnhwthikayrvqregslqvgnea
pitgssplgatqldtdgalwlggmerlsvahklpkaystgfigcirdvivdrqelhlved
alnnptilhcsak

Timeline for d1q56a1:

• d1q56a1 first appeared in SCOP 1.67, called d1q56a_
  
• d1q56a1 appears in SCOPe 2.07