![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (7 families) ![]() |
![]() | Family d.113.1.2: IPP isomerase-like [64369] (3 proteins) |
![]() | Protein Isopentenyl diphosphate isomerase [64370] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [64371] (16 PDB entries) |
![]() | Domain d1q54b_: 1q54 B: [95861] complexed with bhi, mg, mn; mutant |
PDB Entry: 1q54 (more details), 1.93 Å
SCOP Domain Sequences for d1q54b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q54b_ d.113.1.2 (B:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt nsvaghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlkl
Timeline for d1q54b_: