SCOP 1.67: Domain d1q54b_: 1q54 B:

Lineage for d1q54b_ (1q54 B:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (4 families)

5. Family d.113.1.2: IPP isomerase-like [64369] (2 proteins)

6. Protein Isopentenyl diphosphate isomerase [64370] (1 species)

7. Species Escherichia coli [TaxId:562] [64371] (8 PDB entries)

8. Domain d1q54b_: 1q54 B: [95861]
   complexed with bhi, mg, mn; mutant

Details for d1q54b_

PDB Entry: 1q54, 1.93 Å

PDB Description: structure and mechanism of action of isopentenylpyrophosphate- dimethylallylpyrophosphate isomerase: complex with the bromohydrine of ipp

SCOP Domain Sequences for d1q54b_:

Sequence; same for both SEQRES and ATOM records:

>d1q54b_ d.113.1.2 (B:) Isopentenyl diphosphate isomerase {Escherichia coli}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvaghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlkl

Timeline for d1q54b_:

• d1q54b_ is new in SCOP 1.67
  
• d1q54b_ appears in SCOP 1.69
  
• d1q54b_ appears in the current release, SCOPe 2.08, called d1q54b1