SCOP 1.69: Domain d1q54a_: 1q54 A:

Lineage for d1q54a_ (1q54 A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (5 families)

5. Family d.113.1.2: IPP isomerase-like [64369] (2 proteins)

6. Protein Isopentenyl diphosphate isomerase [64370] (1 species)

7. Species Escherichia coli [TaxId:562] [64371] (11 PDB entries)

8. Domain d1q54a_: 1q54 A: [95860]

Details for d1q54a_

PDB Entry: 1q54, 1.93 Å

PDB Description: structure and mechanism of action of isopentenylpyrophosphate- dimethylallylpyrophosphate isomerase: complex with the bromohydrine of ipp

SCOP Domain Sequences for d1q54a_:

Sequence; same for both SEQRES and ATOM records:

>d1q54a_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvaghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaft

Timeline for d1q54a_:

• d1q54a_ first appeared in SCOP 1.67
  
• d1q54a_ appears in SCOP 1.71
  
• d1q54a_ appears in the current release, SCOPe 2.08