SCOP 1.71: Domain d1q53b_: 1q53 B:

Lineage for d1q53b_ (1q53 B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (13 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins)

6. Protein Hypothetical protein AT3G17210.1 [89928] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [89929] (2 PDB entries)

8. Domain d1q53b_: 1q53 B: [95859]
   structural genomics

Details for d1q53b_

PDB Entry: 1q53

PDB Description: solution structure of hypothetical arabidopsis thaliana protein at3g17210. center for eukaryotic structural genomics target 13081

SCOP Domain Sequences for d1q53b_:

Sequence; same for both SEQRES and ATOM records:

>d1q53b_ d.58.4.4 (B:) Hypothetical protein AT3G17210.1 {Thale cress (Arabidopsis thaliana)}
gshmeeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlh
qgythifestfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl

Timeline for d1q53b_:

• d1q53b_ first appeared in SCOP 1.67
  
• d1q53b_ appears in SCOP 1.69
  
• d1q53b_ appears in SCOP 1.73
  
• d1q53b_ appears in the current release, SCOPe 2.08, called d1q53b1