Lineage for d1q53b_ (1q53 B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504226Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (11 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 504252Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins)
  6. 504282Protein Hypothetical protein AT3G17210.1 [89928] (1 species)
  7. 504283Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [89929] (2 PDB entries)
  8. 504286Domain d1q53b_: 1q53 B: [95859]
    structural genomics

Details for d1q53b_

PDB Entry: 1q53 (more details)

PDB Description: solution structure of hypothetical arabidopsis thaliana protein at3g17210. center for eukaryotic structural genomics target 13081

SCOP Domain Sequences for d1q53b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q53b_ d.58.4.4 (B:) Hypothetical protein AT3G17210.1 {Thale cress (Arabidopsis thaliana)}
gshmeeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlh
qgythifestfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl

SCOP Domain Coordinates for d1q53b_:

Click to download the PDB-style file with coordinates for d1q53b_.
(The format of our PDB-style files is described here.)

Timeline for d1q53b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1q53a_