SCOPe 2.04: Domain d1q53a_: 1q53 A:

Lineage for d1q53a_ (1q53 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins)
   automatically mapped to Pfam PF07876

6. Protein Hypothetical protein AT3G17210.1 [89928] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [89929] (3 PDB entries)

8. Domain d1q53a_: 1q53 A: [95858]
   structural genomics

Details for d1q53a_

PDB Entry: 1q53

PDB Description: solution structure of hypothetical arabidopsis thaliana protein at3g17210. center for eukaryotic structural genomics target 13081

PDB Compounds: (A:) expressed protein: At3g17210

SCOPe Domain Sequences for d1q53a_:

Sequence; same for both SEQRES and ATOM records:

>d1q53a_ d.58.4.4 (A:) Hypothetical protein AT3G17210.1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gshmeeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlh
qgythifestfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl

Timeline for d1q53a_:

• d1q53a_ first appeared in SCOP 1.67
  
• d1q53a_ appears in SCOPe 2.03
  
• d1q53a_ appears in SCOPe 2.05
  
• d1q53a_ appears in the current release, SCOPe 2.08, called d1q53a1