Lineage for d1q4ra_ (1q4r A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906842Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1906911Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins)
    automatically mapped to Pfam PF07876
  6. 1906941Protein Hypothetical protein AT3G17210.1 [89928] (1 species)
  7. 1906942Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [89929] (3 PDB entries)
  8. 1906943Domain d1q4ra_: 1q4r A: [95823]
    structural genomics
    complexed with mg

Details for d1q4ra_

PDB Entry: 1q4r (more details), 1.9 Å

PDB Description: gene product of at3g17210 from arabidopsis thaliana
PDB Compounds: (A:) protein At3g17210

SCOPe Domain Sequences for d1q4ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q4ra_ d.58.4.4 (A:) Hypothetical protein AT3G17210.1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlhqgythifes
tfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl

SCOPe Domain Coordinates for d1q4ra_:

Click to download the PDB-style file with coordinates for d1q4ra_.
(The format of our PDB-style files is described here.)

Timeline for d1q4ra_: