Lineage for d1q4qh_ (1q4q H:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 430707Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 430708Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) (S)
  5. 430709Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (5 proteins)
  6. 430721Protein BIR domains of DIAP1 [69974] (1 species)
  7. 430722Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69975] (6 PDB entries)
  8. 430733Domain d1q4qh_: 1q4q H: [95820]

Details for d1q4qh_

PDB Entry: 1q4q (more details), 2.1 Å

PDB Description: crystal structure of a diap1-dronc complex

SCOP Domain Sequences for d1q4qh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q4qh_ g.52.1.1 (H:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster)}
yfpqypeyaietarlrtfeawprnlkqkphqlaeagffytgvgdrvrcfscggglmdwnd
ndepweqhalwlsqcrfvklmkgqlyidtvaakp

SCOP Domain Coordinates for d1q4qh_:

Click to download the PDB-style file with coordinates for d1q4qh_.
(The format of our PDB-style files is described here.)

Timeline for d1q4qh_: