SCOP 1.67: Domain d1q4ob2: 1q4o B:508-592

Lineage for d1q4ob2 (1q4o B:508-592)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.223: Polo-box domain [82614] (1 superfamily)
   beta(6)-alpha; antiparallel beta-sheet, meander

4. Superfamily d.223.1: Polo-box domain [82615] (2 families)
   Serine/threonine protein kinase-associated motif embedded in two distinct folds

5. Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
   duplication: consists of two polo-box domains; binds phosphothreonine peptide

6. Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102858] (3 PDB entries)

8. Domain d1q4ob2: 1q4o B:508-592 [95812]

Details for d1q4ob2

PDB Entry: 1q4o, 2.2 Å

PDB Description: The structure of the polo box domain of human Plk1

SCOP Domain Sequences for d1q4ob2:

Sequence; same for both SEQRES and ATOM records:

>d1q4ob2 d.223.1.2 (B:508-592) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens)}
lpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavtyidekrdfrtyrlsll
eeygcckelasrlryartmvdklls

Timeline for d1q4ob2:

• d1q4ob2 is new in SCOP 1.67
  
• d1q4ob2 appears in SCOP 1.69
  
• d1q4ob2 appears in the current release, SCOPe 2.08