Lineage for d1q4mb_ (1q4m B:)
- Root: SCOP 1.71
Class a: All alpha proteins [46456] (226 folds) 
Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
multihelical; bundleSuperfamily a.132.1: Heme oxygenase-like [48613] (4 families) 
duplication: contains two structural repeats of 3-helical motif
Family a.132.1.3: TENA/THI-4 [101458] (4 proteins)
Pfam 03070; HO-related family lacking the heme-binding siteProtein Seed maturation protein-related At3g16990 [101461] (1 species) Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101462] (1 PDB entry) 
Domain d1q4mb_: 1q4m B: [95806]
structural genomics
complexed with so4
Details for d1q4mb_
PDB Entry: 1q4m (more details), 2.08 Å
PDB Description: Gene Product of At3g16990 from Arabidopsis Thaliana
SCOP Domain Sequences for d1q4mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q4mb_ a.132.1.3 (B:) Seed maturation protein-related At3g16990 {Thale cress (Arabidopsis thaliana)}
rgvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvasvli
rackdsgessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfledlm
ssevkypvimtafwaieavyqesfahcledgnktpveltgachrwgndgfkqycssvkni
aerclenasgevlgeaedvlvrvlelevafwemsrg
SCOP Domain Coordinates for d1q4mb_:
Click to download the PDB-style file with coordinates for d1q4mb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1q4mb_:
- d1q4mb_ first appeared in SCOP 1.67
- d1q4mb_ appears in SCOP 1.69
- d1q4mb_ does not appear in SCOP 1.73
View in 3D
