SCOP 1.67: Domain d1q4ma_: 1q4m A:

Lineage for d1q4ma_ (1q4m A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.3: TENA/THI-4 [101458] (2 proteins)
   Pfam 03070; HO-related family lacking the heme-binding site

6. Protein Seed maturation protein-related At3g16990 [101461] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101462] (1 PDB entry)

8. Domain d1q4ma_: 1q4m A: [95805]

Details for d1q4ma_

PDB Entry: 1q4m, 2.08 Å

PDB Description: Gene Product of At3g16990 from Arabidopsis Thaliana

SCOP Domain Sequences for d1q4ma_:

Sequence; same for both SEQRES and ATOM records:

>d1q4ma_ a.132.1.3 (A:) Seed maturation protein-related At3g16990 {Thale cress (Arabidopsis thaliana)}
gvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvasvlir
ackdsgessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfledlms
sevkypvimtafwaieavyqesfahcledgnktpveltgachrwgndgfkqycssvknia
erclenasgevlgeaedvlvrvlelevafwemsrg

Timeline for d1q4ma_:

• d1q4ma_ is new in SCOP 1.67
  
• d1q4ma_ appears in SCOP 1.69
  
• d1q4ma_ last appears in SCOP 1.71