Lineage for d1q4kb2 (1q4k B:501-594)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007581Fold d.223: Polo-box domain [82614] (1 superfamily)
    beta(6)-alpha; antiparallel beta-sheet, meander
  4. 3007582Superfamily d.223.1: Polo-box domain [82615] (3 families) (S)
    Serine/threonine protein kinase-associated motif embedded in two distinct folds
  5. 3007594Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
    duplication: consists of two polo-box domains; binds phosphothreonine peptide
  6. 3007595Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species)
  7. 3007596Species Human (Homo sapiens) [TaxId:9606] [102858] (28 PDB entries)
  8. 3007656Domain d1q4kb2: 1q4k B:501-594 [95800]

Details for d1q4kb2

PDB Entry: 1q4k (more details), 2.3 Å

PDB Description: The polo-box domain of Plk1 in complex with a phospho-peptide
PDB Compounds: (B:) Serine/threonine-protein kinase PLK

SCOPe Domain Sequences for d1q4kb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q4kb2 d.223.1.2 (B:501-594) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
egdelarlpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavtyidekrdfr
tyrlslleeygcckelasrlryartmvdkllssr

SCOPe Domain Coordinates for d1q4kb2:

Click to download the PDB-style file with coordinates for d1q4kb2.
(The format of our PDB-style files is described here.)

Timeline for d1q4kb2: