Lineage for d1q4ja2 (1q4j A:3-85)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699243Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 699711Protein Pf GST [102442] (1 species)
    cannot be assigned to any of the known GST classes
  7. 699712Species Malarial parasite (Plasmodium falciparum) [TaxId:5833] [102443] (4 PDB entries)
  8. 699715Domain d1q4ja2: 1q4j A:3-85 [95794]
    Other proteins in same PDB: d1q4ja1, d1q4jb1

Details for d1q4ja2

PDB Entry: 1q4j (more details), 2.2 Å

PDB Description: Crystal Structure of Pf-GST1 with its inhibitor s-hexyl-GSH
PDB Compounds: (A:) glutathione s-transferase

SCOP Domain Sequences for d1q4ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q4ja2 c.47.1.5 (A:3-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]}
dnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvpil
qigdlilaqsqaivrylskkyni

SCOP Domain Coordinates for d1q4ja2:

Click to download the PDB-style file with coordinates for d1q4ja2.
(The format of our PDB-style files is described here.)

Timeline for d1q4ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q4ja1