SCOP 1.67: Domain d1q4ja2: 1q4j A:3-85

Lineage for d1q4ja2 (1q4j A:3-85)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (14 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Pf GST [102442] (1 species)
   cannot be assigned to any of the known GST classes

7. Species Malarial parasite (Plasmodium falciparum) [TaxId:5833] [102443] (3 PDB entries)

8. Domain d1q4ja2: 1q4j A:3-85 [95794]
   Other proteins in same PDB: d1q4ja1, d1q4jb1

Details for d1q4ja2

PDB Entry: 1q4j, 2.2 Å

PDB Description: Crystal Structure of Pf-GST1 with its inhibitor s-hexyl-GSH

SCOP Domain Sequences for d1q4ja2:

Sequence; same for both SEQRES and ATOM records:

>d1q4ja2 c.47.1.5 (A:3-85) Pf GST {Malarial parasite (Plasmodium falciparum)}
dnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvpil
qigdlilaqsqaivrylskkyni

Timeline for d1q4ja2:

• d1q4ja2 is new in SCOP 1.67
  
• d1q4ja2 appears in SCOP 1.69
  
• d1q4ja2 appears in the current release, SCOPe 2.08