| Class g: Small proteins [56992] (90 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (22 proteins) |
| Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species) the rest of protein is heme-linked peroxidase, all-alpha fold |
| Species Sheep (Ovis aries) [TaxId:9940] [57211] (20 PDB entries) Uniprot P05979 32-584 |
| Domain d1q4gb2: 1q4g B:32-73 [95792] Other proteins in same PDB: d1q4ga1, d1q4gb1 complexed with bfl, bog, gol, hem, man, nag |
PDB Entry: 1q4g (more details), 2 Å
SCOP Domain Sequences for d1q4gb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q4gb2 g.3.11.1 (B:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}
pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe
Timeline for d1q4gb2: