Lineage for d1q4gb1 (1q4g B:74-584)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358328Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 358329Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 358522Family a.93.1.2: Myeloperoxidase-like [48132] (2 proteins)
  6. 358542Protein Prostaglandin H2 synthase [48136] (2 species)
    contains EGF-like module
  7. 358572Species Sheep (Ovis aries) [TaxId:9940] [48137] (16 PDB entries)
  8. 358574Domain d1q4gb1: 1q4g B:74-584 [95791]
    Other proteins in same PDB: d1q4ga2, d1q4gb2
    complexed with bfl, bog, gol, hem, man, nag

Details for d1q4gb1

PDB Entry: 1q4g (more details), 2 Å

PDB Description: 2.0 angstrom crystal structure of ovine prostaglandin h2 synthase-1, in complex with alpha-methyl-4-biphenylacetic acid

SCOP Domain Sequences for d1q4gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q4gb1 a.93.1.2 (B:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries)}
iwtwlrttlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptynia
hdyiswesfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqg
tnlmfaffaqhfthqffktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklk
yqmlngevyppsveeapvlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvc
dllkaehptwgdeqlfqtarliligetikivieeyvqqlsgyflqlkfdpellfgaqfqy
rnriamefnqlyhwhplmpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagr
igggrnidhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaelee
lygdidalefypglllekchpnsifgesmiemgapfslkgllgnpicspeywkastfgge
vgfnlvktatlkklvclntktcpyvsfhvpd

SCOP Domain Coordinates for d1q4gb1:

Click to download the PDB-style file with coordinates for d1q4gb1.
(The format of our PDB-style files is described here.)

Timeline for d1q4gb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q4gb2