Lineage for d1q4aa_ (1q4a A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 409888Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 409889Superfamily d.22.1: GFP-like [54511] (2 families) (S)
  5. 409890Family d.22.1.1: Fluorescent proteins [54512] (4 proteins)
  6. 409891Protein Green fluorescent protein, GFP [54513] (1 species)
  7. 409892Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (48 PDB entries)
  8. 409900Domain d1q4aa_: 1q4a A: [95784]
    complexed with cro; mutant

Details for d1q4aa_

PDB Entry: 1q4a (more details), 1.45 Å

PDB Description: s65t q80r green fluorescent protein (gfp) ph 8.5

SCOP Domain Sequences for d1q4aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q4aa_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria)}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit

SCOP Domain Coordinates for d1q4aa_:

Click to download the PDB-style file with coordinates for d1q4aa_.
(The format of our PDB-style files is described here.)

Timeline for d1q4aa_: