Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (2 families) |
Family d.22.1.1: Fluorescent proteins [54512] (4 proteins) |
Protein Green fluorescent protein, GFP [54513] (1 species) |
Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (48 PDB entries) |
Domain d1q4aa_: 1q4a A: [95784] complexed with cro; mutant |
PDB Entry: 1q4a (more details), 1.45 Å
SCOP Domain Sequences for d1q4aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q4aa_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria)} skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv ttfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit
Timeline for d1q4aa_: