Lineage for d1q46a_ (1q46 A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 374537Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 374797Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (17 proteins)
    barrel, closed; n=5, S=8
  6. 374818Protein Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain [74950] (2 species)
    includes an all-alpha subdomain in the C-terminal extension
  7. 374819Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101764] (1 PDB entry)
  8. 374820Domain d1q46a_: 1q46 A: [95782]

Details for d1q46a_

PDB Entry: 1q46 (more details), 2.86 Å

PDB Description: crystal structure of the eIF2 alpha subunit from saccharomyces cerevisia

SCOP Domain Sequences for d1q46a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q46a_ b.40.4.5 (A:) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
tshcrfyenkypeiddivmvnvqqiaemgayvklleydniegmillselsrrrirsiqkl
irvgkndvavvlrvdkekgyidlskrrvssediikceekyqksktvhsilrycaekfqip
leelyktiawplsrkfghayeafklsiidetvwegieppskdvldelknyiskr

SCOP Domain Coordinates for d1q46a_:

Click to download the PDB-style file with coordinates for d1q46a_.
(The format of our PDB-style files is described here.)

Timeline for d1q46a_: