Lineage for d1q44a_ (1q44 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109901Family c.37.1.5: PAPS sulfotransferase [52575] (15 protein domains)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2109963Protein Putative steroid sulfotransferase rarO47 [102352] (1 species)
  7. 2109964Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [102353] (1 PDB entry)
  8. 2109965Domain d1q44a_: 1q44 A: [95779]
    complexed with mla

Details for d1q44a_

PDB Entry: 1q44 (more details), 1.9 Å

PDB Description: crystal structure of an arabidopsis thaliana putative steroid sulfotransferase
PDB Compounds: (A:) Steroid Sulfotransferase

SCOPe Domain Sequences for d1q44a_:

Sequence, based on SEQRES records: (download)

>d1q44a_ c.37.1.5 (A:) Putative steroid sulfotransferase rarO47 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
svpaylgdedltqetralisslpkekgwlvseiyefqglwhtqailqgilicqkrfeakd
sdiilvtnpksgttwlkalvfallnrhkfpvsssgnhpllvtnphllvpflegvyyespd
fdfsslpsprlmnthishlslpesvksssckivyccrnpkdmfvslwhfgkklapeetad
ypiekaveafcegkfiggpfwdhileywyasrenpnkvlfvtyeelkkqtevemkriaef
lecgfieeeevreivklcsfeslsnlevnkegklpngietktffrkgeiggwrdtlsesl
aeeidrtieekfkgsglkfs

Sequence, based on observed residues (ATOM records): (download)

>d1q44a_ c.37.1.5 (A:) Putative steroid sulfotransferase rarO47 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
svpaylgdedltqetralisslpkekgwlvseiyefqglwhtqailqgilicqkrfeakd
sdiilvtnpksgttwlkalvfallnrhkfpvsssgnhpllvtnphllvpflegvyyespd
fdfsslpsprlmnthishlslpesvksssckivyccrnpkdmfvslwhfgkklypiekav
eafcegkfiggpfwdhileywyasrenpnkvlfvtyeelkkqtevemkriaeflecgfie
eeevreivklcsfegwrdtlseslaeeidrtieekfkgsglkfs

SCOPe Domain Coordinates for d1q44a_:

Click to download the PDB-style file with coordinates for d1q44a_.
(The format of our PDB-style files is described here.)

Timeline for d1q44a_: