Lineage for d1q40d_ (1q40 D:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. Family d.17.4.2: NTF2-like [54431] (6 proteins)
  6. Protein NTF2-like domain of mRNA export factor MEX67 [89847] (2 species)
    similar to the TAP domain; forms complex with MTR2 similar to the TAP-p15 complex
  7. Species Yeast (Candida albicans) [TaxId:5476] [102808] (1 PDB entry)
  8. Domain d1q40d_: 1q40 D: [95773]
    Other proteins in same PDB: d1q40a_, d1q40c_
    complexed with gol

Details for d1q40d_

PDB Entry: 1q40 (more details), 1.95 Å

PDB Description: Crystal structure of the C. albicans Mtr2-Mex67 M domain complex
PDB Compounds: (D:) mRNA export factor mex67

SCOPe Domain Sequences for d1q40d_:

Sequence, based on SEQRES records: (download)

>d1q40d_ d.17.4.2 (D:) NTF2-like domain of mRNA export factor MEX67 {Yeast (Candida albicans) [TaxId: 5476]}
dsrnlatnfianylklwdanrselmilyqnesqfsmqvdsshphliesgnsgysgstdfg
yylnnsrnltrvssikarmaklsigqeqiyksfqqlpktrhdiiatpelfsmevykfptl
ngimitlhgsfdevaqpevdgsassapsgprggsryhsgpkhkriplskksfdrtfvvip
gpngsmivasdtllirpytsdfpwk

Sequence, based on observed residues (ATOM records): (download)

>d1q40d_ d.17.4.2 (D:) NTF2-like domain of mRNA export factor MEX67 {Yeast (Candida albicans) [TaxId: 5476]}
dsrnlatnfianylklwdanrselmilyqnesqfsmqvdsshphlsgstdfgyylnnsrn
ltrvssikarmaklsigqeqiyksfqqlpktrhdiiatpelfsmevykfptlngimitlh
gsfdevaqpevdgskriplskksfdrtfvvipgpsmivasdtllirpytsdfpwk

SCOPe Domain Coordinates for d1q40d_ are not available.

Timeline for d1q40d_:

Domains from other chains:
(mouse over for more information)
d1q40a_, d1q40b_, d1q40c_